PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G202000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 234aa    MW: 25189.4 Da    PI: 9.928
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G202000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.2e-1364111148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT+eEd +l+ av  +G + W+ Ia+    g  +kqc++rw ++l
  Brast08G202000.1.p  64 KGTWTKEEDNILKAAVDVFGERKWAMIAKSYLPGWIGKQCRERWINHL 111
                         799*************************98777************996 PP

2Myb_DNA-binding47.44.6e-15119159345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          WT+ Ed+ lvda++  G++ W+ Ia++++ gR+++++k+ w+
  Brast08G202000.1.p 119 VWTEAEDLELVDAHRTCGNR-WSVIAKRLP-GRSENSVKNXWN 159
                         7*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.76459115IPR017930Myb domain
SuperFamilySSF466891.35E-2661158IPR009057Homeodomain-like
SMARTSM007171.6E-1263113IPR001005SANT/Myb domain
PfamPF002497.0E-1164111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2065117IPR009057Homeodomain-like
CDDcd001678.01E-1366111No hitNo description
SMARTSM007171.3E-11116164IPR001005SANT/Myb domain
PROSITE profilePS5129413.532116166IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-18118161IPR009057Homeodomain-like
PfamPF002491.1E-13119159IPR001005SANT/Myb domain
CDDcd001671.27E-11120159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGKYLSLGIS GLGGGDAGPN NSAAPANLGF GGGALPVAAM TALAPAPPVA PSAGSNLEDV  60
ERFKGTWTKE EDNILKAAVD VFGERKWAMI AKSYLPGWIG KQCRERWINH LHPNIKNDVW  120
TEAEDLELVD AHRTCGNRWS VIAKRLPGRS ENSVKNXWNA TRRGLRARRL LKKRSSKRQP  180
CPGRLSHLTH YISTLYPPPP STAAASLSPP LLPVQEHEDQ LQAQGGDGII CSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-32611631102MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.12e-53PREDICTED: uncharacterized protein LOC101784221
SwissprotQ9S7L23e-38MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0Q3J3W16e-81A0A0Q3J3W1_BRADI; Uncharacterized protein
STRINGSi004755m6e-53(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.15e-36myb domain protein 118